Journal article
A Novel Murine β-Defensin Expressed in Tongue, Esophagus, and Trachea
The Journal of biological chemistry, Vol.275(43), pp.33314-33320
10/27/2000
DOI: 10.1074/jbc.M006603200
PMID: 10922379
Abstract
β-Defensins are broad spectrum antimicrobial peptides expressed at epithelial surfaces. Two human β-defensins, HBD-1 and HBD-2, have been identified. In the lung, HBD-2 is an inducible product of airway epithelia and may play a role in innate mucosal defenses. We recently characterized rat homologs (RBD-1, RBD-2) of the human genes and used these sequences to identify novel mouse genes. Mouse β-defensin-4 (MBD-4) was amplified from lung cDNA using polymerase chain reaction primers designed from conserved sequences of RBD-2 and HBD-2. A full-length cDNA was cloned which encodes a putative peptide with the sequence MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR. The peptide shares ∼40% identity with HBD-2. MBD-4 mRNA was expressed in the esophagus, tongue, and trachea but not in any of 20 other tissues surveyed. Cloning of the genomic sequence of MBD-4 revealed two nearly (>99%) identical sequences encoding MBD-4 and the presence of numerous additional highly similar genomic sequences. Radiation hybrid mapping localized this gene to a region of chromosome 8 near several other defensins, MBD-2, MBD-3, and α-defensins (cryptdins)-3 and -17, consistent with a gene cluster. Our genomic cloning and mapping data suggest that there is a large β-defensin gene family in mice. Identification of murine β-defensins provides an opportunity to understand further the role of these peptides in host defense through animal model studies and the generation of β-defensin-deficient animals by gene targeting.
Details
- Title: Subtitle
- A Novel Murine β-Defensin Expressed in Tongue, Esophagus, and Trachea
- Creators
- Hong Peng Jia - Department of Pediatrics, University of Iowa College of Medicine, Iowa City, Iowa, 52242Stephen A Wowk - Department of Immunology, Lerner Research Institute, Cleveland Clinic Foundation, Cleveland, Ohio 44195Brian C Schutte - Department of Pediatrics, University of Iowa College of Medicine, Iowa City, Iowa, 52242Sarah K Lee - Department of Immunology, Lerner Research Institute, Cleveland Clinic Foundation, Cleveland, Ohio 44195Andrea Vivado - Department of Pediatrics, University of Iowa College of Medicine, Iowa City, Iowa, 52242Brian F Tack - Department of Microbiology, University of Iowa College of Medicine, Iowa City, Iowa 52242Charles L Bevins - Department of Immunology, Lerner Research Institute, Cleveland Clinic Foundation, Cleveland, Ohio 44195Paul B McCray - Department of Pediatrics, University of Iowa College of Medicine, Iowa City, Iowa, 52242
- Resource Type
- Journal article
- Publication Details
- The Journal of biological chemistry, Vol.275(43), pp.33314-33320
- DOI
- 10.1074/jbc.M006603200
- PMID
- 10922379
- NLM abbreviation
- J Biol Chem
- ISSN
- 0021-9258
- eISSN
- 1083-351X
- Publisher
- Elsevier Inc
- Language
- English
- Date published
- 10/27/2000
- Academic Unit
- Microbiology and Immunology; Pulmonary Medicine; Stead Family Department of Pediatrics; Internal Medicine
- Record Identifier
- 9984093370102771
Metrics
42 Record Views